PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0040s0101.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 706aa    MW: 76944.2 Da    PI: 5.9704
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0040s0101.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.15e-30303360260
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                          +DgynWrKYGqK+vkgse+prsY +Ct+ +C vkkkvers+ ++ v+ei+Y+g Hnh+k
  Kaladp0040s0101.1.p 303 EDGYNWRKYGQKHVKGSEYPRSYLKCTHMNCLVKKKVERSH-EGIVTEIIYKGAHNHPK 360
                          7****************************************.9**************85 PP

2WRKY103.89.4e-33498556159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  Kaladp0040s0101.1.p 498 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCSVRKHVERASHDLKSVITTYEGKHNHD 556
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.674297361IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.9E-26300361IPR003657WRKY domain
SuperFamilySSF1182901.31E-23301361IPR003657WRKY domain
SMARTSM007742.0E-34302360IPR003657WRKY domain
PfamPF031062.4E-23303359IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.2E-37483558IPR003657WRKY domain
SuperFamilySSF1182902.09E-28490558IPR003657WRKY domain
PROSITE profilePS5081138.618493558IPR003657WRKY domain
SMARTSM007742.0E-37498557IPR003657WRKY domain
PfamPF031064.3E-25499556IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MDEHAAAMMG DWVPPSPSPK AFFSSLLGGD EQISSGSIPH ISDEARNGSS SFGSHHSSMG  60
LEDNNANQRD ISFDTDMLYS MLPSHKPSSR VGGLGDRIAA RAGFNAPRLN TEIIRMPDAG  120
EVKSPYLTIP SGISPTTLLE SPIFLSNSLT QASPTTGKFP LIAFEDNRSS MLAGKSKEDL  180
FVDGSAFAFK PHAEPSFSFL PGTTNIMSQA MNPQSFPKEV SAMSENIFQN SEQSQVNSHM  240
CLSQSPTEKD LGERTAGSEI RGLDTISFTA EHSPPLDDQH DDEGDQRVSS DSYADGSAGS  300
LEEDGYNWRK YGQKHVKGSE YPRSYLKCTH MNCLVKKKVE RSHEGIVTEI IYKGAHNHPK  360
PAANRRSSMT PNLFDDTHDQ VGLENGAERD SVWSAARNGF EHNSEPGNPL SSLQMQHGAM  420
LESVNAVDPS TTLSNDEEED DRGTHGSVSV ANDVVEEDES ESKRRKIETY VAEIGGGATR  480
AIREPRVVVQ TTSDVDILDD GYRWRKYGQK VVKGNPNPRS YYKCTSAGCS VRKHVERASH  540
DLKSVITTYE GKHNHDVPAA RNSSRVNSAA AMGSQSQSII PRNEPSQVTN MARYERPPHL  600
SSFNLPMMQS LGPPPHGFPM GVNQSSLANM LIAGLGPGQN KFQGMPAHPY PMLQQQQQPQ  660
RDVNGMGFMM PKGEAQVEPN LDPNAYPSNG SSVYHQIINR LPLGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-34301559878Probable WRKY transcription factor 4
2lex_A1e-34301559878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002265612.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_010644699.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_010644700.10.0PREDICTED: probable WRKY transcription factor 2
SwissprotQ9FG771e-163WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLA0A140H8R80.0A0A140H8R8_MANES; WRKY transcription factor 64
STRINGVIT_19s0015g01870.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-151WRKY DNA-binding protein 2